DPCstruct | MC20869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 203 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0104- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1DTL7 | 188-399 | FALSSEPVDRAWYDHLQAISSVAADIGGVASTHINHLTPRVLDIDDLYRRMTERGIAMIDRIQGPPLTTKPAVLLRQTSFRALAEPR… |
| A0A093V961 | 223-458 | TLDIELVQKEMISQGLPAKDGIEGPPNRSCPILLRQTSFRALEEPVNFFNEGYSLVHSTHAARFGEIEQRGAAVTPQGRALYDKCLH… |
| A0A423VBW8 | 218-442 | None |
| A0A5C6TDX5 | 164-395 | None |
| A0A522AMG6 | 3-180 | None |
| A0A5N6U3B6 | 20-195 | None |
| A0A3D0K1V6 | 339-521 | None |
| A0A654U3Z3 | 29-224 | None |
| A0A748M7W2 | 165-378 | None |
| A0A377ZIH3 | 215-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.