DPCstruct | MC20867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 350 ± 93 aa |
| Standard deviation of domain lengths | 92.90 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A093UTL7 | 142-427 | EVSRGNLKGLLETCSQDLSGAQLQGFLQSAMMCLAKTHSYTYNFVRATRTQSIPANLGDSVGDFYQKCIEVELPDLDAARFIASALI… |
| A0A7U2R165 | 192-537 | YNELLDALHLRSVELGECFSVVRLFRLAGDYLSPLARYQRLRDEVYRQREEVANTKNGHQMLFSAVHLMSFFEKAVQHTARTISQEF… |
| A0A194VMA6 | 94-422 | None |
| A0A2U3DRS0 | 189-468 | None |
| A0A2U3DPT9 | 76-368 | None |
| A0A401L9R2 | 2-236 | None |
| X0H1J6 | 3-312 | None |
| A0A6A5TKZ4 | 109-435 | None |
| A0A1Y2DD17 | 25-249 | None |
| A0A162MFL5 | 99-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.