DPCstruct | MC20865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842Z7V6 | 1-105 | MPDCYVTNCGGKCKAGWIKIEQQPCGGAKPLTRHSNKKDSQLCCPLEAAPDPDDCVWRGEAPPCNGQCHDNEVTMQLNRWGDGAYCE… |
| A0A093UKJ6 | 13-120 | TLKPTVSYWENQQPGACETTSCGGSCSPGTIEITTVTCPSGGKKPQKLCCPIASAPDPSTCTWRGGPGLCNGQCHGGEVALASSKDG… |
| A0A2C5ZIA3 | 19-124 | None |
| E3QSM3 | 139-245 | None |
| A0A6A5QBY9 | 7-160 | None |
| A0A1L9PNC0 | 7-114 | None |
| A0A4X3P282 | 1-125 | None |
| A0A0G4KVY0 | 95-189 | None |
| A0A1C7MHJ3 | 55-159 | None |
| F0X6K8 | 320-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.