DPCstruct | MC20852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 116 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0611 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1I2F8 | 784-893 | QIAGVDYIQSAKLMLNGHDRYSERPGTYHRLVQPYQHHPRVPSKPVYVYSFALESSSHQPSGATNFSRIDNAQLYLTTKPNMPAARC… |
| A0A6C0F1B1 | 1-114 | MHCWGENPVVTAKLQLNGQDRFSEREGSYFDVVQPFQHHTRAPDTGINVYSFALRPEEHQPSGTCNFSRIDNAVLQLVLSSGTVSGT… |
| A0A329RC37 | 32-145 | None |
| A0A6C0DEX7 | 151-265 | None |
| A0A6C0D2T9 | 59-165 | None |
| A0A6C0LQI8 | 334-447 | None |
| A0A846PM96 | 8-139 | None |
| L8GMV5 | 75-190 | None |
| A0A6C0I135 | 625-736 | None |
| A0A6C0HCL1 | 416-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.