DPCstruct | MC20845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 193 ± 26 aa |
| Standard deviation of domain lengths | 25.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0ELY3 | 22-221 | VKIYTEFEYSFKKYVLPYLPKYIEQTIIDFSENGNIICKSYSFDKMNENRKKIKSIDFVLHKEYDKTSEKYNARVVDNLRNYQNIEF… |
| A0A6C0CNN8 | 10-250 | LPHVFNTQYYYLCIIYIYTVTLGWIRSKILNPLNNYIDLYLKCEPPYTQWLHIYCMNVSFCETMSGIDKTFYGSDEIYYIPFIEDFS… |
| A0A6C0LJW6 | 37-245 | None |
| A0A6C0LI78 | 41-260 | None |
| A0A6C0I3B7 | 229-394 | None |
| A0A6C0HRF7 | 4-213 | None |
| A0A6C0HQR8 | 28-189 | None |
| A0A3S5JN31 | 8-221 | None |
| A0A6C0KJ64 | 33-204 | None |
| A0A2D5LNI5 | 29-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.