DPCstruct | MC20839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 131 ± 16 aa |
| Standard deviation of domain lengths | 15.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6X390 | 1-97 | MSLTVVTHGAVITGRLAPESVWRQRVSEVLTDSADLGVFSAAFDAPAEKKEAPTHLHFHVARILQGTMGIPETGGMYRVAIDDVSAW… |
| A0A1N6UZ53 | 23-147 | IDGHLASLVGLINNNPGICIGITLTVGGTLISGELISGKEYFDNLATLLHRDDQVEDSIRNVLSDEMKWMSNRYSTPDINKTVYIHL… |
| A0A1X1VU65 | 4-134 | None |
| A0A7V6RMD8 | 15-160 | None |
| U6SJ26 | 1-130 | None |
| A0A7K2NI65 | 79-196 | None |
| K4ZGK3 | 39-156 | None |
| A0A0M4RAP1 | 14-148 | None |
| H0TH47 | 21-131 | None |
| B9JWL5 | 131-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.