DPCstruct | MC20837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7HFH0 | 1-64 | MKIIFNRVLLHLFRYLTSRNDVQVWQKKDRHGRSYWQAYDPLTDKKISLASEAEMRIWIEQRYY |
| A0A2T1CU98 | 7-67 | IANILRKAVDSLVISNHEPQVRYKCDRHGNHYWQVYDFNTNKSYIFGSEQDVRVWIENRHY |
| A0A6G3Z6Y6 | 20-93 | None |
| A0A6M8B7T6 | 58-128 | None |
| A0A2T1DE07 | 15-81 | None |
| A0A1Z4JG17 | 17-89 | None |
| A0A0F5YCJ0 | 2-68 | None |
| A0A3M9ZBE0 | 91-162 | None |
| A0A2T1EBE5 | 3-75 | None |
| A0A2T1DVK7 | 68-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.