DPCstruct | MC20835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 26.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7L4B1 | 98-238 | SAEADLLKENLIILVSGTIVPSLSFKNKAIRKTAMEMLDELSKSDPEFVLKVVNNIAQELNIRFTTNFLLAYAAANEACRPYIGKYF… |
| A0A452H9Y5 | 48-207 | QRSGRHGWLWPGGKAASPAALSELCEELAQLEPEFILKVSLYTRQELNIRGTANFLLALAARLPPCRPHLRRYLCATLQLPSDWIQV… |
| L8GW11 | 8-195 | None |
| A0A3Q0E335 | 214-409 | None |
| A0A6A5DET8 | 41-181 | None |
| A0A2G8LIZ8 | 58-197 | None |
| A0A3R7LM57 | 54-240 | None |
| A0A670ZI67 | 37-181 | None |
| A0A5C6P162 | 208-356 | None |
| S4RXY6 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.