DPCstruct | MC20834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 210 ± 33 aa |
| Standard deviation of domain lengths | 32.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7F0S6 | 2-165 | AYECLSARGRRKKSGVNGRLYSELLKKICQDGEAPEEVVSSLLRKIQCRDHEAVPFDVFRYGVLSCFVLLEFVAKADTLYDVLDDGS… |
| A0A452GXV5 | 2-236 | VREALLKVLEARPEEPVSFLASYFEKLVLSGPQGGAAGDRHGQQQRLVRALWYVRLAHHSHRTAFNNNVSMAYECLSARGRRKKPGV… |
| F7BVX7 | 46-276 | None |
| A0A7I8VJF1 | 11-183 | None |
| A0A3R7AFC8 | 1-177 | None |
| R7TJC7 | 31-268 | None |
| A0A662Y8Q7 | 4-191 | None |
| A0A3B3TYW3 | 117-333 | None |
| A0A833SPR5 | 3-270 | None |
| A0A1Y1WUQ7 | 5-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.