DPCstruct | MC20830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 180 ± 18 aa |
| Standard deviation of domain lengths | 17.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 34.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00038 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9SHQ6 | 6-159 | QSTAVQQEVNTNTEALQSSKSQIKELKRTLQNLEIEMQAELSRKQGLENTLDETQCTAGAQLQKIQELICQMEAELSRVRNDLSRQS… |
| A0A452GEY7 | 2-160 | VAQELATSAEATQGARTKITELRRVVQGLEIELQSLHSMKEALEGTLAETQAGYGDKLTQLRGRGARKEAELVQLRTDAQRQAEEHQ… |
| A0A663MNY0 | 112-280 | None |
| A0A6G0HGQ9 | 3-162 | None |
| A0A834DV52 | 2-223 | None |
| A7TUG6 | 277-480 | None |
| A0A6I9Z5F0 | 179-359 | None |
| A0A2J8IVB1 | 20-185 | None |
| A0A5F4WKY0 | 317-496 | None |
| F6WZZ8 | 19-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.