DPCstruct | MC2083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03994 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827NLM9 | 167-289 | NFSAYFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVIPLSSATINAVSIPDYFAWGGIALVIQLLVFAGVRL… |
| A0A6M6JEX4 | 6-144 | FFSVIGVGIGAILLYAVLGVILMLLGFYAVDLTTPGKLNVMVREGLPNAVVITAAGMISMALIVVTAIYTSSGFLTEGLIQTAIFGV… |
| F4TP86 | 34-158 | None |
| A0A2G4IPZ7 | 39-160 | None |
| C5B6G6 | 27-149 | None |
| A0A364K5J1 | 41-174 | None |
| Q7NXU7 | 6-131 | None |
| A0A7C4F344 | 48-188 | None |
| A0A1I0MFT3 | 6-130 | None |
| U1Y9L2 | 197-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.