DPCstruct | MC20829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 264 ± 37 aa |
| Standard deviation of domain lengths | 37.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1GT40 | 24-225 | NNSLKQAFFTYAIVRSFNGMISTLQESSISFGIGVDANIALGQVLDPINDAIERFSDMITLSLWVLGAEKIIYEISKFNIIFFIFLI… |
| A0A6N7D7S4 | 1-292 | MTADNAAVTTASTTPPRSALLRRLPALVLLALLCAAAWFGGGLDARATRQADAGLQRALASFATARALHALISVAQGTALAVQPAGV… |
| A0A2Z2NL43 | 1-245 | None |
| A0A7X8PNF8 | 2-279 | None |
| A0A7I0NQD4 | 9-279 | None |
| A0A3T0K6R3 | 10-241 | None |
| N6YS99 | 1-257 | None |
| A0A0S7ZJS0 | 6-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.