DPCstruct | MC20826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 518 ± 79 aa |
| Standard deviation of domain lengths | 78.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2CSD5 | 2-425 | FQIAAYAARSEDRWPKWQEPIVSLLEQEGGFKGFIKSLISDPNAGWKNKEAKRRAKQDQETEKSRNGNIAELTPNLAVIASGAPTQF… |
| A0A5N7JS54 | 2-579 | SSTTLSVLAAAPELMQWHGSELGDIKGALTTLVPAWPDLNDALFWRCIENCRTRQARRKQNLKDDWLVSCSWHFWAFDADSFPRMLN… |
| A0A564WEX2 | 385-905 | None |
| A0A2N7SPX3 | 60-568 | None |
| A0A2G2C3G4 | 120-699 | None |
| A0A2G2HSG7 | 10-604 | None |
| A0A1E7I1C5 | 40-583 | None |
| A0A419GQS1 | 412-969 | None |
| A0A2G6JEI1 | 2-429 | None |
| A0A4Z0W6G3 | 472-980 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.