DPCstruct | MC20823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 129 ± 22 aa |
| Standard deviation of domain lengths | 21.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11749 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8QP89 | 13-151 | QRKPLKSIWQPFQWLPAEVVLSPLPAGAPRCLRDDPSETLWLYPGLSMRLYSDEAEGYFLNLDSGAPCWFIMWRLEGEAAVPQFVTL… |
| A0A357IDA3 | 23-139 | VRKQTDDIQARTLLKQTTDYRLYLHTGLSISLYVDQAESYYHNLMMRTPRVFVVCRDAEGQDPAPFLVTASADEANAYVETDEWAEA… |
| A0A2S7XD32 | 15-145 | None |
| A3KAX2 | 1-108 | None |
| A0A536T567 | 1-119 | None |
| A0A2T5VAS9 | 7-119 | None |
| A0A6N8UXW2 | 67-207 | None |
| A0A0B8P9M7 | 20-128 | None |
| A0A352SQY8 | 17-180 | None |
| A0A4Y9M0X9 | 17-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.