DPCstruct | MC20817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 9 aa |
| Standard deviation of domain lengths | 9.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F4PPG3 | 31-155 | LTSITDNPGFNYFKSTLLQVIEQRRPELSGQHHFYVAHYREGSEYTYMFWQEARLFWVLHLGTPEEYGWMSMLLPSSGELLHIDKDV… |
| A0A0S9F8D6 | 4-122 | AYLSTKDEVHNSRYARQINRFCFLKQAPRASVYGDTGGILMIWHNGGEILDSGGRAVRGEAAASLGRAEALAKSVHLATDVVESEAQ… |
| W0LK36 | 33-159 | None |
| A0A7X6YG79 | 180-296 | None |
| A0A7I8FX56 | 16-140 | None |
| A0A7W6NWV9 | 7-129 | None |
| A0A7X7BBR1 | 117-247 | None |
| A0A210W866 | 1-109 | None |
| A0A7R8BAR7 | 19-148 | None |
| A0A0J1GJP1 | 64-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.