DPCstruct | MC20814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670HZ39 | 113-187 | CNGSGGLGHLCPKDSSCAPNGPGLPQCLCTSPHYGYKCLRQGTFPYLLFFGALGAVTIALSLLLWVTQRRKAKVS |
| A0A815VID4 | 104-173 | NSQICPEPHSYCSPNGPNHTLCLCKGTYHGYKCLRSGQFPTAVFLGSACAVTVLTAALFYWTTRRHVGKH |
| A0A7I8VDU6 | 296-367 | None |
| A0A6J3JRT7 | 129-205 | None |
| H0ZXG0 | 368-459 | None |
| A0A5C6NPT4 | 1-78 | None |
| A0A3M6T8Q6 | 48-112 | None |
| A0A673MWC6 | 33-108 | None |
| A0A5E4A943 | 152-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.