DPCstruct | MC20809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 332 ± 99 aa |
| Standard deviation of domain lengths | 98.52 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7WR86 | 28-350 | MAGARIEADYAAMPEEAKVALLLGLLNDARSLQVRGAVYSERTRGELAIFEAAREGRALYGHAAIRHCIISHTETVSDLLEVLVLQK… |
| A0A378E8W4 | 60-204 | QAFLIRELNSKRPLLPRQWEPSEETREVLDTCKVIAEAPRGSISAYVISMAKTPSDVLAVHLLLKEAGIGFALPVAPLFETLDDLNN… |
| A0A0D3CPI9 | 282-493 | None |
| A0A1E1F3J4 | 407-630 | None |
| A0A6A3ARV7 | 25-446 | None |
| A0A446U7E8 | 349-767 | None |
| A0A6A5L1F7 | 256-634 | None |
| A0A812SIN1 | 596-1003 | None |
| A0A378W3L9 | 52-211 | None |
| A0A820UCH0 | 321-693 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.