DPCstruct | MC20808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 151 ± 23 aa |
| Standard deviation of domain lengths | 22.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0377 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853FVM8 | 1-154 | MLSDDLIHALARDFYEAEQSRVQVRAPSVRYPDLTMADAYAIQNAWVEMKIASGNPIKGFKIGLTSRAMQMAVGISEPDHGVLLEDM… |
| W7WPR2 | 1-147 | MPPAAHDAAQLLWRCRQSGNVIDALPDALRPGDAAAGHAIQAALAQVAGSPVVGWKIAATSAAGQAHIQVDGPLPGRILGSFVHAMG… |
| A0A1I3G9W0 | 3-161 | None |
| A0A7S1XQ77 | 24-216 | None |
| A0A3S5J9R2 | 18-154 | None |
| Q5BHA0 | 63-229 | None |
| A0A535VRH6 | 5-147 | None |
| A0A3E0CVM8 | 25-168 | None |
| A0A354VHL5 | 8-168 | None |
| A0A7S0TUR2 | 65-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.