DPCstruct | MC20806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0RY84 | 1-88 | MSDSDLAKAFGDNFQAFKHPTTPNATTDKIREVAGRSLTGDAQKDNEIQLARELLKRDNVMKALDSVDDNGKRDGVIGPWNPKMAADQ |
| A0A1T2YE48 | 1-92 | MSDHDLLQNLKQNFGQISQGIYNGYVNFDEVRKAAGVMASDATYSPQVRELAQELLKRQPLLNELDIGTNGYGGKGIKDQRFDIDNI… |
| A0A1S2TDC1 | 51-137 | None |
| A0A3G7U8I6 | 44-138 | None |
| A0A1S1UX14 | 2-90 | None |
| A0A6I1LD80 | 254-347 | None |
| A0A7M1KI24 | 113-207 | None |
| A0A219A9G1 | 207-301 | None |
| A0A855QBX2 | 77-172 | None |
| A0A423FH35 | 54-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.