DPCstruct | MC20801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 129 ± 29 aa |
| Standard deviation of domain lengths | 28.74 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF03140- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6F0I5 | 4-103 | AGKLLDPADKSGQLSLAGRALQKHGSREGSAFPSDKGSPSEINAQGQKIADEILSNPAATVTYKDTGRFGKVMDVIAPDGRGLRYDS… |
| A0A7S1C8E3 | 10-149 | VRAVMHLLGMRRTFKSVTLLPPSRAVLCASFEALHSQHAVPATSRAKPSQLTVGARALAKHCHRASSGWWGAAAGSEAAKNAWGREV… |
| A0A7S3LVX7 | 22-139 | None |
| A0A6G6J954 | 330-435 | None |
| T1EYC6 | 30-130 | None |
| X6QDX2 | 284-440 | None |
| F8LE97 | 5-81 | None |
| A0A7V6QL04 | 33-148 | None |
| A0A1S3E8D9 | 128-272 | None |
| A8JB35 | 214-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.