DPCstruct | MC2080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X7F5A5 | 51-185 | KFEINKVATELNRIIAEYRNNRITVKFRPGDREASEELANKLNGLFRADYEETDGGEACDNAFDDAATGGFGCFRLTSMLVNEYDPM… |
| A0A377JX36 | 52-163 | PITENIYKMIVNKILGYKISSMQEIKLTPRQEQDKPLTDLLNDILKYITQNKNYDKEIIKRDRDLIFGMSVCEVWITQDIEGKEVEI… |
| Q3ETV3 | 13-186 | None |
| A0A827YLF7 | 1-151 | None |
| A0A6N8MUY2 | 5-162 | None |
| A0A6A7JTE5 | 54-188 | None |
| A0A060PXU7 | 52-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.