DPCstruct | MC208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 3.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8DE85 | 4-65 | QRRSFSVEFKHDAAALVVDQGYSVAEACKSMGVGETALRRWVDQLREERSGVTPKLLAQKPE |
| A0A0P9SIJ5 | 1-57 | MTKQRRTFSAEFKREAAGLVLDQGYSHIEAARSPGVVESALRRWVNQLQQERNGVKP |
| A0A2U9HPR6 | 1-63 | None |
| A0A7Z0S0N6 | 1-62 | None |
| A0A3E0DG95 | 1-71 | None |
| A0A0A7A3V5 | 70-130 | None |
| Q31Z58 | 13-75 | None |
| A0A6G3DVG9 | 5-64 | None |
| A0A2G8CF88 | 12-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.