DPCstruct | MC20795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 78 ± 3 aa |
| Standard deviation of domain lengths | 2.69 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 93.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0T3H3 | 1-78 | MPPPPHGPEGHTWRHADAALYHTIAKGWRDPFNKTDRLTMPAFEEILTPDEIRAVSTYLKTLWTEEQRQFQWEQSEDR |
| A0A1R3V9L8 | 72-150 | MPAPPHDASGHSWHHPDGVLFRVTKEGPAAVVRGGYESDMPAFAGMMTDEEIRAVLTFIKSTWPERERQYQAEMSRREQ |
| A0A1F2X788 | 35-113 | None |
| A0A2N0LXJ3 | 51-123 | None |
| A0A3M1RE62 | 299-375 | None |
| A0A7C1JGL9 | 107-182 | None |
| A0A375JB43 | 1-79 | None |
| A0A7C1X843 | 68-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.