DPCstruct | MC2079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 134 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6J1G8 | 133-255 | MFRVLLDMHEDEGRLRASLKALRQQVKQLKNFSGYTPPVVLVGEFSGPETPWIVVRGKTHLACTHDGSALTLDEWRRLPESVIRLPY… |
| A0A827MY19 | 1-137 | LLPEQHTSDEAFLSWLRNWQRAVMQCRQWLNTMPPVLVTLMVSGPSPQNTSLNKHSAHWFTLTPDLSGMHIRLTEAGAIPAEEWLRE… |
| A0A2X3C9W0 | 5-143 | None |
| A0A7T1SSN7 | 129-258 | None |
| A0A378BCD0 | 109-241 | None |
| A0A377TZA3 | 69-200 | None |
| A0A3S4DU41 | 129-261 | None |
| A0A2X1TGT2 | 278-414 | None |
| A0A7H4N0F5 | 45-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.