DPCstruct | MC20789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A558RDH6 | 28-115 | FEAVLDRLLGEQVRADGACGVDLWCALTNTRWFGPDGVEVSYGFRRAGHAVAWVREEGDDLTWYCSGEPGQVAQWIEEVLAGAGWSWR |
| A0A519CSY0 | 1-106 | MLNECNLERDLIDCQPIKDKVRKDDRYATRLYDALCNTKWYHDSDVHGGRTKGDAWSCSWRYAGDLVAKLRVSHEDYLDYYCSGNEG… |
| A0A2R4MEK1 | 5-97 | None |
| A0A5R9P146 | 2-99 | None |
| A0A4Y3ZQL4 | 1-93 | None |
| A0A0G4I990 | 12-112 | None |
| K5Z1T7 | 44-160 | None |
| A0A7U0G486 | 88-203 | None |
| A0A4R2T2Y5 | 85-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.