DPCstruct | MC20783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 211 ± 33 aa |
| Standard deviation of domain lengths | 32.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4R097 | 133-351 | NDKLIALTIATDGLPTDEEGNEDEHTNIEFVNVLKLFASLPVVIIVRLSTDEERVVNFYNELNSFLTTTTPTTRHDNNQLPPTTSPM… |
| A0A138ZX02 | 157-414 | VDIIAYIPTLSNTFRFLNRADVIRISHKQHTPMSFASTLKSQLETIFRRGPSGSTPMRAKIGQIFSEAEREMQRTVVYIFCDGMPDE… |
| A0A7S3AZZ4 | 100-269 | None |
| A0A7S2S344 | 2-165 | None |
| A0A7R9VKZ4 | 6-189 | None |
| A0A7S4HST9 | 3-156 | None |
| A0A7S2PS45 | 238-449 | None |
| K0SCJ7 | 293-493 | None |
| A0A7S4QI03 | 157-348 | None |
| A0A830HB93 | 235-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.