DPCstruct | MC20781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 476 ± 86 aa |
| Standard deviation of domain lengths | 86.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0287- CL0202- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7F6F6 | 12-418 | GELRYIARLSRSLLPNGDPESYTDLGSETVEGSDVFRQSNGQTVSKFYSSERFIDDKVHYVSGSDVIISMVIPDPTSYEGSAGGPFF… |
| A0A803NLI2 | 5-433 | SSGFYAYAIYEHLKEWPPFNLPQTRIVFKLRKDKFQYMAVGDNRQRHMPLPDDRVPPRGKELAFPEAVLLVNPVEPEFKGEVDDKYE… |
| A0A834TVF9 | 444-898 | None |
| A0A2G2XA98 | 76-672 | None |
| A0A4Q2XEJ4 | 46-532 | None |
| A0A1U8NMN2 | 387-975 | None |
| A0A6P6G9G5 | 6-500 | None |
| A0A3A9D349 | 30-659 | None |
| B8B9E7 | 633-1145 | None |
| A0A4P1RN47 | 291-691 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.