DPCstruct | MC20780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 192 ± 27 aa |
| Standard deviation of domain lengths | 26.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821VPL6 | 30-204 | DQHYFVTYIPLPTNIEDGATIEQWIERMTFICDDLTWLLQQNHIKFWCEVAFNKDFHSMLDSYLRYAPRPQRTISINNYSSIINGKE… |
| A0A803NJN9 | 18-191 | GADEGGLDPVESQKVVDLLNRELSRLLKLNPNEFWREVALDTSLRDFLDSFLQFRNRWYDFPHHGVKGNVAGVIVGEDDLSRRVFMV… |
| A0A183BDP2 | 29-214 | None |
| A0A817BXJ2 | 34-221 | None |
| A0A5E4QBK1 | 16-284 | None |
| A0A3P6NZP7 | 21-198 | None |
| A0A445C8A2 | 69-266 | None |
| A0A1I8GJS6 | 28-250 | None |
| A0A182FK56 | 1-222 | None |
| T1KUX0 | 64-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.