DPCstruct | MC2078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378MXN7 | 13-133 | IYFGFRGGRLDLNGNSIAFKRIQNSDKHARIVNHNRDHISTLIIQGQDPLTSNDLIWGKWASNSPADIYEYTNPYQNKRKDYFRLKG… |
| A0A827MX98 | 2-126 | GIPGGGYLDINGKDTEFSRLQAVDYGAAIINSSTDKSLLTLNLSPLKKDEIAVSVKALDMNAIFQGGHGTAGDLYKTTFYGPTQYYL… |
| A0A2H3MAT1 | 276-373 | None |
| A0A378F342 | 425-550 | None |
| A0A509D1P8 | 20-124 | None |
| A0A828B2Y4 | 51-141 | None |
| A0A811ARD3 | 87-201 | None |
| A0A379SHH8 | 478-605 | None |
| A0A811AQW5 | 3-105 | None |
| A0A811APN8 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.