DPCstruct | MC20778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 60.59 |
| Pfam Score | 26.67 |
| Assigned Pfam label(s) | PF01000- CL0509- CL0267- PF05695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420Z7J0 | 9-87 | FEIKKEGRKGNYGKFVISPLTKGYGNTLGNSLRRVLLTDLPGSAITSVRITGVKHQFSTLKGMKQDIVEFILNLKKVNF |
| A0A7J6HUE5 | 1-75 | MGQEKVIVSTRPLQWKCVESRTDSKRLYYGRFILAPLMRGQADTIGIVMRRALLGEIEGTCITRAKSDKIPHEYS |
| A0A3P6DU55 | 44-122 | None |
| A0A804U9A4 | 1-79 | None |
| A0A822ZXF0 | 1-79 | None |
| A0A6M3QLF4 | 1-75 | None |
| G7ICM8 | 69-143 | None |
| A0A5J5TXA5 | 1-82 | None |
| A0A444X2X8 | 1-77 | None |
| D3WCW2 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.