DPCstruct | MC20776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Standard deviation of domain lengths | 24.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5V4K7 | 26-154 | EETTYALGDVDMDGVVTGHDTAMVSRYVLDDTYTLTEEQLKLADVNEDGVVDQADADKLYTEMQVYSLGDIDMSGMAEVGDTSDILV… |
| R5J7D4 | 39-175 | KYKVGDVNLDGTLDAFDLVRIKKYLAKQVELTDESKINADINLDGNIDKLDEALLKKYLAGYKMDLPYLKYKAGDANLDGIVDIFDL… |
| A0A2H0YRL2 | 81-248 | None |
| A0A1V5M0V6 | 24-165 | None |
| A0A1V5NMY3 | 410-562 | None |
| A0A7V1BJP1 | 285-505 | None |
| A0A7Z9GB54 | 54-192 | None |
| A0A1V5MM98 | 2-167 | None |
| A0A1K2A5M7 | 1089-1211 | None |
| A0A0L6JUP2 | 566-706 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.