DPCstruct | MC20774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 187 ± 22 aa |
| Standard deviation of domain lengths | 22.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8HYB5 | 21-181 | LTPISNPTDLTGIQTTSKRDASFTGDLNLQDFETFYWGSAAGKNLVYANLTVYFPEQYEYVIAMERFAGKLKSVNCAEDMMLEFNDD… |
| A0A074W058 | 1-200 | MLLSLLSIFLLPTTAVLASPITLSNSDPTQKTFYPITDTTIDRHADYPLYPHYSTALLFSEKPKTTLAISTTFDTRYPTVILENSAR… |
| A0A178EPR5 | 323-494 | None |
| A0A1Y2HXE6 | 1-182 | None |
| A0A0S6XNK0 | 179-375 | None |
| A0A0C9LMV7 | 180-377 | None |
| A0A420TDC5 | 45-259 | None |
| A0A086T3N2 | 717-923 | None |
| A0A2K1QSR5 | 2-197 | None |
| A0A6A5U2L3 | 34-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.