DPCstruct | MC20773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 159 ± 27 aa |
| Standard deviation of domain lengths | 27.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A3A5Y0 | 1-180 | MPSQQLTKNTDDTLSSSWITPITIRSQEYYAKTLPPKDFKSENLIAINRDGDRIDSYFPMPPKDVWEAYNRRARNHKICNKLHLGGE… |
| A0A074VZM1 | 1-150 | MPNTITPTPSDTSSWATVGNGASKTINIAAKKAPNRKLIALNTNEERIDPPLPRTDPAATTRLIERVRHKKVCNNYHLIGKCKSGKY… |
| A0A5C2SGS4 | 649-768 | None |
| A0A6A7ADK3 | 71-240 | None |
| A0A146I2P1 | 287-421 | None |
| A0A5N6EI28 | 40-200 | None |
| A0A2S5BCC3 | 104-230 | None |
| A0A4U0VZ75 | 1-135 | None |
| A0A3N4LY30 | 83-233 | None |
| A0A194XN40 | 206-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.