DPCstruct | MC20771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 160 ± 28 aa |
| Standard deviation of domain lengths | 27.74 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074VNQ7 | 14-169 | QVSAGEAYLKRKSDPEKWKADLLQGSLYRKRRYMEDSEYRNRILSASRARHKVNQATDETYRNKRTMASLIRRCTWFREELPWKSHR… |
| A0A074VNM3 | 42-201 | KYYTNPEWRSRKIEQGTITTARRRQDPELREKERVRDRVYHEKRKQSKSFLLWRRLFQWCFYHDWVRDQLPWKTYRPRLYPEKVEHH… |
| A0A4V4IET3 | 99-262 | None |
| A0A074YZB8 | 12-200 | None |
| A0A074YF56 | 48-199 | None |
| A0A074Y9T2 | 304-444 | None |
| A0A4S9HKC0 | 18-155 | None |
| A0A074X0Y4 | 17-170 | None |
| A0A074WRE0 | 125-289 | None |
| A0A074WJ38 | 38-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.