DPCstruct | MC2077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 20.14 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 76.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5W4L7L5 | 95-198 | VRGGVAKLDEGHRLAALWQALPEELRLSPHRYLATNSPQGPWWLLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTFHREAAG… |
| A0A827MVQ9 | 2-105 | WLVRGGKAAQPDGHTLGRLWGALPPDIRLSPHLYLATSSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGLADRFGRTLTYRREA… |
| A0A656BZ75 | 54-206 | None |
| A0A6D0X1J1 | 146-269 | None |
| A0A6D0C2H7 | 91-216 | None |
| A0A830WL04 | 65-174 | None |
| A0A828K7L7 | 80-189 | None |
| A0A829ACT3 | 143-251 | None |
| A0A077ZH48 | 132-240 | None |
| A0A376SAV6 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.