DPCstruct | MC20766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6PRP3 | 27-102 | VIRILAIGNSFSQDAIENYLHQLAEASGKQTIIANMYIGGCTLERHYNNAQNNTSAYSYRKIGVDGMKVSKEGVTL |
| A0A7G1HX15 | 24-105 | VIKVLAVGNSFSENAIEQNLYQLAEANGDTLIIGNMFIPGCTINRHWECAQSEEAAYQYRKIVNGKKVNTSNKSMLECIRDE |
| A0A1M2ZDA4 | 28-116 | None |
| A0A1F3F638 | 557-638 | None |
| A0A268HXG8 | 2-77 | None |
| A0A1R4IF61 | 68-144 | None |
| I8WYA3 | 16-100 | None |
| A0A355JGK2 | 200-295 | None |
| R7FR65 | 92-178 | None |
| A0A316RPM3 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.