DPCstruct | MC20765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0567 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S5X4B5 | 3-81 | KVTLSSPVKRGDAEISTVELREPSAGELRGLDNFDVLRMNVGAHRTLVPRISNITANEFDMLRPKDLIAVQQEVVAFFM |
| A0A4R3J9N6 | 2-93 | LNDNTVRLQYPIVRTLTGSGGVREENIETVTLRRAKLKDLRGLNLKALETLEGDTLETLIQRLSGLSKVEVGELDLADLEGLSLVIE… |
| E2CN25 | 4-86 | None |
| A0A2G0YRP7 | 22-111 | None |
| A0A7J0BVD3 | 24-123 | None |
| A0A1I5DRG1 | 9-95 | None |
| A0A2L0AF52 | 2-90 | None |
| W0BWL8 | 10-104 | None |
| A0A377AJY3 | 1-61 | None |
| A0A3R8T6U2 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.