DPCstruct | MC20764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016UVG6 | 313-427 | RLVCPRPWTMPTGELCPATVRWMSESVLMTIVSSPGITLKDICFRLEFALQPVAVHDLVTVLIGAGCVNEVDEVFENMKMPSPFEKE… |
| A0A3B1IR74 | 681-807 | RDGEGSKQEEDLSFVARPWRIVDGSLNRPVCKGMLEALLLHIMTNPAIPEPALLNHYSGVLQPVVILDLLQVLMELGCVKRRCAEIQ… |
| A0A5B7D2D7 | 1003-1116 | None |
| A0A368FTQ2 | 4-102 | None |
| A0A4W6DK61 | 233-352 | None |
| A0A2R2MQ10 | 160-267 | None |
| L5KGV9 | 291-397 | None |
| A0A2A2K7J2 | 1053-1153 | None |
| A0A0B2V4U0 | 1-95 | None |
| D5ADY1 | 272-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.