DPCstruct | MC20763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 308 |
|---|---|
| Mean domain length (aa) | 234 ± 53 aa |
| Standard deviation of domain lengths | 53.05 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.76 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0027- CL0033- PF01063- CL0240- PF19275 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4F6T9 | 7-138 | GITLTVSPIRLARQPLLAGIKHLNRLEQVLIRAHLAQTQADEALVLDTQDRLVECCAANLFWRCGQQVFTPRLTQCGVDGVMRQRIC… |
| A0A3B1IPT5 | 3-280 | ANLFEGMKAYRGADGRVRLFRPMLNMTRMLKSANRACLPGFDRGELLECIRKLVEVDQEWVPQSESASLYIRPTFIGTEPSLGVKKP… |
| A0A7G2M474 | 19-200 | None |
| A0A496BQ25 | 18-204 | None |
| A0A0D9VEI6 | 32-254 | None |
| A0A318SC69 | 18-225 | None |
| B5VQ57 | 6-202 | None |
| A0A812PF49 | 11-268 | None |
| A0A2W6AJZ5 | 2-152 | None |
| A0A7V2UKE9 | 273-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.