DPCstruct | MC20762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 16.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | PF11952- PF14724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4Y660 | 5-107 | IDALISNAKSKDDQVDQMRGCNEAERHWLARKQFLLKNWDDFTEDNREKLECLSQCWSGLHFLGVGYPPQTVEKVREMSFGLPNMSD… |
| A0A3B1IP44 | 2-93 | AARAAYRTVSESEKHWRPRRDFIFRNINDYEDPHLDHLLALSMVWANHVFLGCRYSEELLNKVKEMAEGIVVEDAPVFKTRDEIVKN… |
| A0A553MX10 | 7-100 | None |
| A0A5E4QC30 | 2-128 | None |
| A0A383ZBD4 | 10-96 | None |
| A0A5J4NJD2 | 56-120 | None |
| A0A4Y2BDL3 | 28-123 | None |
| H2YMP0 | 4-97 | None |
| A0A6P9ABB2 | 5-112 | None |
| A0A820A3W6 | 13-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.