DPCstruct | MC20759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 141 ± 26 aa |
| Standard deviation of domain lengths | 26.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0UTS6 | 2-106 | IFVQIPECAKPFYLPLQKAILEAGAHGIFEYYPDGVARHFFEQATQEQLTFYPEHYLHGKVDQMTHVISIIAEHDKYELKGVDPQKL… |
| A0A7G3DTY8 | 1-149 | MENFTEKLEKYAELAVKVGVNIQQGQTLVIKTTLDAAVLVRLIAKKAYEAGANDVVVQWSDDAVDRLRFAMAPEETLQTFSTWYAKE… |
| A0A7W1M2P3 | 466-605 | None |
| A0A0A2TJ83 | 1-162 | None |
| A0A1W9SYV4 | 23-162 | None |
| A0A1G7RU62 | 1-158 | None |
| A0A538I402 | 2-133 | None |
| A0A7X6YPZ4 | 323-460 | None |
| A0A849PSQ8 | 205-362 | None |
| Q3EKF6 | 16-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.