DPCstruct | MC20754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 202 |
|---|---|
| Mean domain length (aa) | 286 ± 68 aa |
| Standard deviation of domain lengths | 67.65 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.87 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | PF13018- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5YSW4 | 303-578 | GGSITNGGSSLLAKNSLTLDSQNSISNLSNGLMKAGGDLNLSAIGDINNISSTISGKTVALESLDGSINNLTQVEQIDINAGGKYGN… |
| A0A522IZT2 | 71-336 | KLGIGSSAASSRTAPHDEATYGSAIRSAGDVAIAATDADLNVIGSRIDGQNVALAASHDLTLEGQAEQHTLASTNKNASGGVGLQIG… |
| A0A1N7USH6 | 48-317 | None |
| A0A7G2SD90 | 86-365 | None |
| A0A4V0WMY2 | 3-189 | None |
| A0A1P8JYH9 | 33-353 | None |
| A0A378N7H5 | 3-317 | None |
| A0A3S5F3J6 | 31-283 | None |
| A0A1D3DHL1 | 5-189 | None |
| A0A2V3QSE4 | 4-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.