DPCstruct | MC2075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2NKD7 | 10-112 | TTVVIYTEESEELTKEVFIYLQDLNGDGELFFNVDYEVQHEDGSFENGNGMESLDIILDAYGFEDYNKLSSYFRYMYENDKDAFSKI… |
| A0A4S8PJN7 | 4-111 | PKRPGVVLRSERSPGQYHSMRAHVDDEGTLHVEGEDVDPLLDSFVGKGEVEWSYKVRAEHLPALVEALGGEPGADVIDLLAERYTGE… |
| A0A0K0XZY9 | 9-104 | None |
| A0A6J7E1P8 | 157-258 | None |
| A0A7V9DEK5 | 2-116 | None |
| A0A1W9HQ18 | 2-103 | None |
| A0A1A2XE21 | 33-147 | None |
| A0A359LT28 | 2-98 | None |
| A0A1H7L9F9 | 1-92 | None |
| A0A847VSD7 | 4-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.