DPCstruct | MC20748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.89 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0125- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7I529 | 14-133 | SSQFDDDGRVKRTGTLLTASAHIITAVIGSGVLSLAWALAQLGWIAGPIALIAFSIITWFTSTLLADSYRSPFNGTRNYTYREAVKN… |
| A0A103XM82 | 8-128 | HFDDDGRIRRTGTLMSASAHIITTVVGSGVLSLSWCFAQLGWITGIVLLVAFAIITWFTCLLLADCYRSPDPVTGTRNYNYMQAVKA… |
| K7MWR2 | 1-117 | None |
| A0A7J6VU69 | 98-208 | None |
| Q1PFX2 | 19-138 | None |
| A0A7J0FCS1 | 9-128 | None |
| A0A2H5P7I4 | 25-145 | None |
| A0A453G7G8 | 84-209 | None |
| A0A453G2K3 | 1-105 | None |
| A0A1D6MYN3 | 49-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.