DPCstruct | MC20747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 211 |
|---|---|
| Mean domain length (aa) | 113 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.27 |
| Pfam Score | 96.81 |
| Assigned Pfam label(s) | CL0274- PF10533- PF03208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4MXP1 | 5-82 | KVSVRARSEAPMTTDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCTVRKQVQRCAEDKTILITTYEGNHNHPLPPAAM |
| A0A103XJ01 | 8-122 | VNNLNKRKFVECEEGNTSGRTETLHQGSLKRPNEGVTRVVKDGYQWRKYGQKVTRDNPSPRAYYKCSFAPSCTVKKKVQKSVDDAHL… |
| A0A5N5J8L2 | 442-523 | None |
| A0A803PYN4 | 119-204 | None |
| A0A445CUL7 | 32-145 | None |
| E7CEY0 | 27-157 | None |
| A0A396HTL3 | 63-184 | None |
| M4DRI0 | 21-143 | None |
| A0A834T8R6 | 347-462 | None |
| A0A3S3Q860 | 80-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.