DPCstruct | MC20746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 153 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 62.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0VBM6 | 1-143 | MRASISKGARAPSKLSSKSLELCTENLGSESGTDIIEDENNIFSPICFGDGSGDHSIKVHPRKSHVASSKRRAPKTFPPPLSTMTGS… |
| A0A103XH93 | 1-157 | MLSPSASLINHKPDFNHQHYTMSLESLSICTEGLGFESFDDVEDQLETDSHEVKLGTTTTTTTTTTTKRAAAISMLGDGGKRSRITG… |
| A0A5N6P4S3 | 27-188 | None |
| A0A6A4PBH5 | 5-150 | None |
| A0A287QYY6 | 1-165 | None |
| A0A2G2Y0J2 | 1-123 | None |
| A0A7I8L7F6 | 23-194 | None |
| A0A804I5L6 | 34-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.