DPCstruct | MC20742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 195 ± 27 aa |
| Standard deviation of domain lengths | 27.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838PGD5 | 10-206 | ELDRSEVRGRTLLRAGNSIDNVGTGPAELHGTRLGPRFMRGRQRIYKRGGGRLGINTGARLFFKFVPGQKRYWKFYRAASFTLWRLD… |
| A0A1M3BMR1 | 11-198 | VLHATSNVESRGRGPMELHGQRNGPKKMKVNQRIYKKGGGHITVRTGASLHFTDVGAYFGGSYWKVHQLARFELLPVLPDGTLGEVV… |
| A0A6F9ZY97 | 133-335 | None |
| A0A1I8FV69 | 321-535 | None |
| A0A498NNG7 | 386-604 | None |
| A0A538ILD3 | 4-163 | None |
| A0A7W0KH18 | 3-174 | None |
| D2HKZ8 | 87-298 | None |
| A0A838RYW8 | 19-250 | None |
| A0A820SGU1 | 25-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.