DPCstruct | MC2074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 159 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8PHS1 | 2-134 | SEATIAAAFALQVELSTRIATRPLPEGQGLLSEAIGSLKALFDAARAAIRELGSADRDDEVALLAGKLAETLRPFLTEWQPRLDGHL… |
| A0A561UNC6 | 14-177 | VKLAVPMIGEISGVWEPVDAERKAAWELYVELVTRVAVVELGPDEGVLREAMNSLYSLFATTRDILRRYGPEVAPRRDPGYVSFGAL… |
| A0A0P8BX58 | 74-229 | None |
| A0A7H8T7R3 | 8-180 | None |
| Q2LRS3 | 49-233 | None |
| A0A2A9F9Y4 | 13-173 | None |
| A0A517QE39 | 50-234 | None |
| A0A384I186 | 33-202 | None |
| A0A094KYW7 | 47-200 | None |
| A0A7Y7NKP9 | 144-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.