DPCstruct | MC20736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 214 ± 34 aa |
| Standard deviation of domain lengths | 34.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2EHC1 | 226-431 | LNCRKESEMYNPEIFCRILRPKNYPIARFPDNPEFSLALMQQVAVNLSIGFDNEQIRSVNGPPGTGKTTLLKDIFAELIVEQAYEMA… |
| A0A553ANC9 | 67-256 | LNSFFIPDLERAMASVSAGETPAALRQYLTPLPPQDRCNLFSAQGRETIVDMLAPDRMNRGRWFADPRHAMSLMQQFAINAATTRLA… |
| A0A2S0JAV3 | 59-289 | None |
| H8K2W5 | 1-208 | None |
| U2CXI4 | 191-395 | None |
| A0A446C8P6 | 35-303 | None |
| A0A7X7KU51 | 197-392 | None |
| A0A529M875 | 331-549 | None |
| A0A6B3VWZ0 | 2-297 | None |
| A0A227KGB6 | 276-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.