DPCstruct | MC20731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 13 aa |
| Standard deviation of domain lengths | 13.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2BRZ9 | 6-157 | RSGQAGMTKKSGIIMFYRVVADIIVIVHFLWILFMLIGVGFTVWAFLGVYVFRACGGWCERFFDWAGFRVLHLCGIVYVGLLATMGK… |
| A0A552X5Z9 | 15-138 | YPSLMADIVMILHALIVLFVIVALPLTIIGGIQRWRWIRNTWFRLTHLVIILVVVIQALSGRYCPLTYVEQDLRLAAGQTSYDTSFV… |
| A0A7C1GT79 | 172-293 | None |
| A0A6B0Z5P5 | 6-149 | None |
| A0A1V5CZ27 | 44-189 | None |
| A0A2G8SZA3 | 13-145 | None |
| A0A2E6NS11 | 4-131 | None |
| A0A7V9NN38 | 2-115 | None |
| I3UGG6 | 3-146 | None |
| A0A7C1X0M3 | 11-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.